PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00565.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 714aa    MW: 81349.8 Da    PI: 7.3718
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00565.1_g00011.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.34.2e-5161341128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeel+++yLk+kveg ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF+ +dkky++g r+nr tk+gyWk
  Rsa1.0_00565.1_g00011.1   6 LPPGFRFHPTDEELIDYYLKRKVEGIEIEL-EVIPVIDLYKFDPWELPdKsFLPNRDMEWFFFCLKDKKYPNGFRTNRGTKAGYWK 90 
                              79****************************.99**************96435556888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++++++++ ++g +ktLvfykgrap g +t+W+mheyrl
  Rsa1.0_00565.1_g00011.1  91 ATGKDRKITCRSSPTIGYRKTLVFYKGRAPLGDRTSWLMHEYRL 134
                              ******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-583159IPR003441NAC domain
PROSITE profilePS5100557.5326159IPR003441NAC domain
PfamPF023653.8E-277134IPR003441NAC domain
PfamPF077276.7E-45319473IPR013103Reverse transcriptase, RNA-dependent DNA polymerase
SuperFamilySSF566722.96E-22337452No hitNo description
SuperFamilySSF566722.96E-22477662No hitNo description
CDDcd092726.11E-73558693No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MGSSCLPPGF RFHPTDEELI DYYLKRKVEG IEIELEVIPV IDLYKFDPWE LPDKSFLPNR  60
DMEWFFFCLK DKKYPNGFRT NRGTKAGYWK ATGKDRKITC RSSPTIGYRK TLVFYKGRAP  120
LGDRTSWLMH EYRLCDDESS SQDSQSFKGA FVLCRVTKKN EIKSNSKIQR NLNEQTLGSG  180
ESSGYSSRVT SPSRDDTMPF HSFVNSVSTE TDTSNIWISP DFILDSSKDY PQIQDVAPEY  240
FQDFDFPVLS NQNVDVPAST LNANVDQNMD ESMQTGYWTN RWLVAKGYTQ QEGLDYVETF  300
SPVTKLATIK LLLAVAAAKE EIYMTLPPGY SGRQGESFPP NAVCKLKKSL YGLKQASRQW  360
FLKFSKALHD LGFKTSSGDH TLFIKNSGSV YMAVLVYVDD IIIASSCDQA TELLKAALQA  420
SFKLRDLGTL CYFFGLEVAR SSAGISICQR KYVFDLLTET ELLGCKPSSI PMDSSVKLSI  480
EVGELLEDAE QYRWLVGKLL YLTFTRTDIT FAVHKLCQFT STPRRPHLQA AYKILHYLKE  540
TAGQGLFYSA VSNLRLSAFA DADWGSCPDS RRSITGYCMF VGSALIAWHS TKQETVSHSS  600
AKSEYRAMSE AVREMLWFRM MMEDLWIDVH EAAPLYCDNT AAIHIANNSV FHERTKHMER  660
DCHIVRERVK MGMIITLHVR SEHQLADILT KPLFPTQFRH LLSKMEFINI YVPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-46616115171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM4CW550.0M4CW55_BRARP; Uncharacterized protein
STRINGBra008452.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21512777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.11e-156NAC domain containing protein 96